PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676723606
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family YABBY
Protein Properties Length: 231aa    MW: 26002.9 Da    PI: 10.5544
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676723606genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY2061.4e-636620722170
      YABBY  22 lavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlksnveke....esastsvsseklsenedeevprvppvir 117
                ++vsvP++slf++vtvrCGhCt+lls+n+ ++ ++ a            ++++l+ ++++++s v+++    +s s+++ s++lsen d+e+pr+pp ir
  676723606  66 IVVSVPYASLFTLVTVRCGHCTNLLSLNIGVSLHQSAPPP---------VHQDLQ-HKQHITSSVTRKecgsSSRSSNHFSTTLSENVDREAPRMPP-IR 154
                79****************************9988766555.........333332.23333333333300003444444445679**********99.9* PP

      YABBY 118 PPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170
                PPekrqrvPsaynrfikeeiqrika+nP+ishreafs+aaknWahfP+ihfgl
  676723606 155 PPEKRQRVPSAYNRFIKEEIQRIKAGNPEISHREAFSTAAKNWAHFPHIHFGL 207
                ***************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046903.8E-6065207IPR006780YABBY protein
SuperFamilySSF470951.7E-7152200IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.101.8E-4155201IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
GO:0010158Biological Processabaxial cell fate specification
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MVPSHIVLRT LWAVVKVTSF SNMTVFSLQA SSTILHLFTI FYHIALRIVC QTYIKIGLTS  60
QSNYRIVVSV PYASLFTLVT VRCGHCTNLL SLNIGVSLHQ SAPPPVHQDL QHKQHITSSV  120
TRKECGSSSR SSNHFSTTLS ENVDREAPRM PPIRPPEKRQ RVPSAYNRFI KEEIQRIKAG  180
NPEISHREAF STAAKNWAHF PHIHFGLKLD GNKKGKQLDQ TVAGQKSNGY Y
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3533260.0AK353326.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-29-D23.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013710952.11e-115PREDICTED: putative axial regulator YABBY 2 isoform X3
SwissprotQ9XFB01e-107YAB2_ARATH; Putative axial regulator YABBY 2
TrEMBLA0A078E3G01e-113A0A078E3G0_BRANA; BnaC05g06120D protein
TrEMBLA0A0D3C8I31e-113A0A0D3C8I3_BRAOL; Uncharacterized protein
STRINGBra018624.1-P1e-111(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM55812749
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08465.11e-101YABBY family protein